PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000478512
Common NameMYB35
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 390aa    MW: 42851.6 Da    PI: 5.5048
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000478512genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding513.4e-164388147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+W++eEd  l ++v  +G ++W++Iar +  gR++k+c++rw + 
    MDP0000478512 43 KGPWSPEEDAVLTRLVSNFGARNWSLIARGID-GRSGKSCRLRWCNQ 88
                     79******************************.***********985 PP

2Myb_DNA-binding569.4e-1895139147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r+++T eEd  +v a++ +G++ W++Iar ++ gRt++ +k++w++ 
    MDP0000478512  95 RKPFTHEEDRMIVAAHAIHGNK-WAAIARLLP-GRTDNAIKNHWNST 139
                      789*******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.543889IPR017930Myb domain
SuperFamilySSF466895.03E-3041136IPR009057Homeodomain-like
SMARTSM007174.2E-134291IPR001005SANT/Myb domain
PfamPF002495.4E-154388IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-254496IPR009057Homeodomain-like
CDDcd001671.16E-124587No hitNo description
PROSITE profilePS5129426.59990144IPR017930Myb domain
SMARTSM007177.0E-1794142IPR001005SANT/Myb domain
PfamPF002495.2E-1595139IPR001005SANT/Myb domain
CDDcd001671.16E-1297140No hitNo description
Gene3DG3DSA:1.10.10.606.8E-2497143IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 390 aa     Download sequence    Send to blast
METEVADDPA AVDIEAGYGG VDSGEEAVXG GGSRRKSGRD NVKGPWSPEE DAVLTRLVSN  60
FGARNWSLIA RGIDGRSGKS CRLRWCNQLD PAVKRKPFTH EEDRMIVAAH AIHGNKWAAI  120
ARLLPGRTDN AIKNHWNSTL KRRCMDTDKI KLESGNMVED VSFDKTKGSS EETSYGDVNS  180
SKSMEGREVS SLEHMDDQDE YNGSSEVQFS HEATEQPTLF RPMARISAFS VYNQSNSQEP  240
ASSFPRPIPV QGPLVQASKL DVGINKFLEG VYGERSVPXR CGHGCCRAES GMNFQNSLLG  300
PEFVEFSEPP LFPSFELAAI ATDISNLAWL KSGLENNSVR AVGETAGRIT THGSQDQTGR  360
FEESRXNHLF PTEERKDRLM GMKTNVXST*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-40401434107B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.246770.0bud| root
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00337DAPTransfer from AT3G09230Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ0744590.0DQ074459.1 Malus x domestica MYB2 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008388098.10.0PREDICTED: transcription factor MYB44-like
TrEMBLD9ZJ630.0D9ZJ63_MALDO; MYB domain class transcription factor
STRINGVIT_08s0007g01540.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF39863362
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G09230.11e-101myb domain protein 1